• Nenhum resultado encontrado

Os resultados mostraram a obtenção de plantas transgênicas de Coffea arabica contendo o gene para o inibidor α-AI1 de P. vulgaris. Os genes nptII e α-AI1, além de terem sido inseridos no genoma do café, passaram para a descendência das plantas avaliadas. Essa transformação levou à expressão do inibidor ativo nas sementes de cafeeiro, sendo capazes de bloquear in vitro as -amilases do H.

hampei. Isto torna essas plantas promissoras como método de controle da broca-do-café.

Bioensaios serão necessários para comprovar a eficiência da expressão do inibidor α-AI1 no controle do H. hampei. No entanto, para que essa avaliação seja feita de forma adequada, é necessária a obtenção de plantas transgênicas homozigotas para o transgene bem como a avaliação do número de cópias inserido em cada planta. Essas plantas homozigotas podem expressar o inibidor em concentrações maiores do que as observadas nesse trabalho, o que deve aumentar a eficiência da planta no controle do inseto. Porém, essa obtenção é demorada, devido ao longo ciclo de vida do cafeeiro, que necessita de pelo menos 3 anos para começar a produzir as primeiras sementes.

Obviamente, um longo caminho ainda será percorrido, caso essa planta se mostre eficiente no controle da broca-do-café. Avaliações de segurança, como equivalência substancial, testes de alergenicidade, avaliação de progênie e testes ambientais ainda serão necessários antes que essa planta seja introduzida no mercado. Porém, todo o esforço e investimentos feitos foram válidos, pois essa planta de C. arabica transgênica poderá controlar o principal inseto-praga do cafeeiro, responsável por centenas de milhões de dólares de prejuízo anualmente, e a sua utilização diminuirá os custos de produção do café e o impacto ambiental causado pela utilização de inseticidas.

7. Referências Bibliograficas.

ALBUQUERQUE, E. V. S., et al. Transgenic coffee fruits from Coffea arabica genetically modified by bombardment. In Vitro Cellular & Developmental Biology - Plant v.45, n.5, p.532-539. 2009.

ALBUQUERQUE, E. V. S., et al. Gus-expression in fruits of Coffea arabica genetically modified by bombarment. In Vitro Cellular & Developmental Biology – Plant. v.Submitted 2009.

ALFENAS, A. C. Eletroforese de isoenzimas e proteínas afins: fundamentos e aplicações em plantas e microrganismos. Viçosa: UFV. 1998. 574 p.

ALPIZAR, E., et al. Intermediate resistance to Meloidogyne exigua root-knot nematode in Coffea arabica. Crop Protection. v.26, n.7, Jul, p.903-910. 2007.

ALTABELIA, T.CHRISPEELS, M. J. Tobacco Plants Transformed with the Bean aai Gene Express an Inhibitor of Insect a-Amylase in Their Seeds. Plant Physiology.

v.93, p.805-810. 1990.

ARAGÃO, F. J. L., et al. Inheritance of foreign genes in transgenic bean (Phaseolus vulgaris L.) co-transformed via particle bombardment. Theoretical and Applied Genetics. v.93, p.142-150. 1996.

BELLINCAMPI, D., et al. Potential physiological role of plant glycosidase inhibitors.

Biochim Biophys Acta. v.1696, n.2, Feb 12, p.265-74. 2004.

BENAVIDES, P., et al. Biodiversity and Biogeography of an Important Inbred Pest of Coffee, Coffee Berry Borer (Coleoptera: Curculionidae: Scolytinae). Annals of the Entomological Society of America. v.98, n.3, p.359-366. 2005.

BERNFELD, P. Amylases, alpha and beta. Methods in Enzymology. v.1, p.149-158. 1955.

BERTRAND, B., et al. Impact of the Coffea canephora gene introgression on beverage quality of C. arabica. Theoretical and Applied Genetics. v.107, p.387–

394. 2003.

BERTRAND, B., et al. Disease complex in coffee involving Meloidogyne arabicida and Fusarium oxysporum. Plant Pathology. v.49, n.3, Jun, p.383-388. 2000.

BHAT, S. R.SRINIVASAN, S. Molecular and genetic analyses of transgenic plants:

Considerations and approaches. Plant Science. v.163, p.673-681. 2002.

BISHOP, J. G., et al. Rapid evolution in plant chitinases: Molecular targets of selection in plant-pathogen coevolution. Proceedings of the National Academy of Sciences of the United States of America. v.97, n.10, May, p.5322-5327. 2000.

BOMPARD-GILLES, C., et al. Substrate mimicry in the active center of a mammalian alpha-amylase: structural analysis of an enzyme-inhibitor complex. Structure. v.4, n.12, Dec 15, p.1441-52. 1996.

BOXTEL, J. V.BERTHOULY, M. High frequency somatic embryogenesis from coffee leaves : Factors influencing embryogenesis, and subsequent proliferation and regeneration in liquid medium. Plant Cell Tissue and Organ Culture. v.44, p.7-17.

1996.

BRASILEIRO, A. C. M. Manual de Transformação Genética de Plantas. Brasília:

Embrapa-Cenargen. 1998. 309 p.

BRAVO, A., et al. Mode of action of Bacillus thuringiensis Cry and Cyt toxins and their potential for insect control. Toxicon. v.49, n.4, Mar, p.423-435. 2007.

BRAVO, A.SOBERON, M. How to cope with insect resistance to Bt toxins? Trends in Biotechnology. v.26, n.10, Oct, p.573-579. 2008.

BURGESS, E. P. J., et al. Effects of protease inhibitor concentration and combinations on the survival, growth and gut enzyme activities of the black field

cricket, Teleogryllus commodus. Journal of Insect Physiology. v.40, n.9, Sep, p.803-811. 1994.

BURNETTE, W. N. "Western blotting": electrophoretic transfer of proteins from sodium dodecyl sulfate--polyacrylamide gels to unmodified nitrocellulose and radiographic detection with antibody and radioiodinated protein A. Analytical biochemistry. v.112, n.2, p.195-203. 1981.

BURNS, G. W.BOTTINO, P. J. Genética: Guanabara Googan. 1991. 384 p.

CAFEZAL, O. Espécies e variedades: características influenciam escolha. 2010.

http://www.coffeebreak.com.br/ocafezal.asp?SE=3&ID=16.

CANCHE-MOO, R. L. R., et al. Genetic transformation of Coffea canephora by vacuum infiltration. Plant Cell Tissue and Organ Culture. v.84, n.3, Mar, p.373-377.

2006.

CARLINI, C. R.GROSSI-DE-SA, M. F. Plant toxic proteins with insecticidal properties. A review on their potentialities as bioinsecticides. Toxicon. v.40, n.11, Nov, p.1515-1539. 2002.

CHAGOLLA-LOPEZ, A., et al. A novel alpha-amylase inhibitor from amaranth (Amaranthus hypocondriacus) seeds. J Biol Chem. v.269, n.38, Sep 23, p.23675-80.

1994.

CHEN, Z., et al. Colletotrichum gloeosporioides can overgrow Colletotrichum kahawae on green coffee berries first inoculated with C. kahawae. Biotechnol Lett.

v.27, n.10, May, p.679-82. 2005.

CLARINDO, W. R.CARVALHO, C. R. Comparison of the Coffea canephora and C.

arabica karyotype based on chromosomal DNA content. Plant Cell Rep. v.28, n.1, Jan, p.73-81. 2009.

CUBRY, P., et al. Diversity in coffee assessed with SSR markers: structure of the genus Coffea and perspectives for breeding. Genome. v.51, n.1, Jan, p.50-63. 2008.

DA SILVA, M. C., et al. Analysis of structural and physico-chemical parameters involved in the specificity of binding between alpha-amylases and their inhibitors.

Protein Eng. v.13, n.3, Mar, p.167-77. 2000.

DAMON, A. A review of the biology and control of the coffee berry borer, Hypothenemus hampei (Coleoptera : Scolytidae). Bulletin of Entomological Research. v.90, n.6, Dec, p.453-465. 2000.

DE AZEVEDO PEREIRA, R., et al. An alpha-amylase inhibitor gene from Phaseolus coccineus encodes a protein with potential for control of coffee berry borer (Hypothenemus hampei). Phytochemistry. v.67, n.18, Sep, p.2009-16. 2006.

DE SOUSA-MAJER, M. J., et al. Bean alpha-amylase inhibitors in transgenic peas inhibit development of pea weevil larvae. J Econ Entomol. v.100, n.4, Aug, p.1416-22. 2007.

DE SOUSA-MAJER, M. J., et al. Response to water deficit and high temperature of transgenic peas (Pisum sativum L.) containing a seed-specific alpha-amylase inhibitor and the subsequent effects on pea weevil (Bruchus pisorum L.) survival.

Journal of Experimental Botany. v.55, n.396, Feb, p.497-505. 2004.

DOYLE, J. J.DOYLE, J. L. A rapid DNA isolation procedure for small quantities of fresh leaf tissue. Phytochemical Bulletin. v.19, p.11-15. 1987.

DUFOUR, M., et al. Coffee (Coffea SP.) Genetic Transformation for Insect Resistance. In: SERA, T., et al (Ed.). Coffee Biotechnology and Quality: Springer, 2000. Coffee (Coffea SP.) Genetic Transformation for Insect Resistance, p.209-217

ENCARNAÇÃO, R. D. O.LIMA, D. R. Café & Saúde Humana. Brasília: Embrapa Café. 2003

ENGVALL, E.PERLMANN, P. Enzyme-linked immunosorbent assay (ELISA).

Quantitative assay of immunoglobulin G. Immunochemistry. v.8, n.9, p.871-874.

1971.

FAKHOURY, A. M.WOLOSHUK, C. P. Inhibition of growth of Aspergillus flavus and fungal alpha-amylases by a lectin-like protein from Lablab purpureus. Molecular Plant-Microbe Interactions. v.14, n.8, Aug, p.955-961. 2001.

FORNAZIER, M., et al. Danos da broca-do-café em café arábica em nível de propriedade agrícola, no estado do Espírito Santo - Safra Agrícola 99/00. II Simpósio de Pesquisa dos Cafés do Brasil. Vitória: Embrapa Café, 2001. p.

FRAGOSO, D. B., et al. Insecticide use and organophosphate resistance in the coffee leaf miner Leucoptera coffeella (Lepidoptera: Lyonetiidae). Bull Entomol Res.

v.92, n.3, Jun, p.203-212. 2002.

FRANCO, O. L., et al. Plant alpha-amylase inhibitors and their interaction with insect alpha-amylases - Structure, function and potential for crop protection. European Journal of Biochemistry. v.269, n.2, Jan, p.397-412. 2002.

GANESH, D., et al. Monitoring of the early molecular resistance responses of coffee (Coffea arabica L.) to the rust fungus (Hemileia vastatrix) using real-time quantitative RT-PCR. Plant Science. v.170, n.6, Jun, p.1045-1051. 2006.

GIBBS, B. F.ALLI, I. Characterization of a purified alpha-amylase inhibitor from white kidney beans (Phaseolus vulgaris). Food Research International. v.31, n.3, p.217-225. 1998.

GROSSI-DE-SÁ, M. F., et al. Molecular characterization of a bean alpha-amylase inhibitor that inhibits the alpha-amylase of the Mexican bean weevil Zabrotes subfasciatus. Planta. v.203, n.3, Nov, p.295-303. 1997.

GUERREIRO, O.MAZZAFERA, P. Caffeine and resistance of coffee to the berry borer Hypothenemus hampei (Coleoptera : Scolytidae). Journal of Agricultural and Food Chemistry. v.51, n.24, Nov, p.6987-6991. 2003.

HANDOO, Z. A., et al. Morphological and molecular evaluation of a Meloidogyne hapla population damaging coffee (Coffea arabica) in Maul, Hawaii. Journal of Nematology. v.37, n.2, Jun, p.136-145. 2005.

HAQ, S. K., et al. Protein proteinase inhibitor genes in combat against insects, pests, and pathogens: natural and engineered phytoprotection. Archives of Biochemistry and Biophysics. v.431, n.1, Nov, p.145-159. 2004.

HATANAKA, T., et al. Transgenic plants of coffee Coffea canephora from embryogenic callus via Agrobacterium tumefaciens-mediated transformation. Plant Cell Reports. v.19, p.106-110. 1999.

HENDRE, P. S., et al. Development of new genomic microsatellite markers from robusta coffee (Coffea canephora Pierre ex A. Froehner) showing broad cross-species transferability and utility in genetic studies. BMC Plant Biol. v.8, p.51. 2008.

HERNANDEZ, A., et al. Characterisation of Meloidogyne spp. (Tylenchida : Meloidogynidae) from coffee plantations in Central America and Brazil. Nematology.

v.6, p.193-204. 2004.

HERRERA, J. C., et al. Introgression into the allotetraploid coffee ( Coffea arabica L.): segregation and recombination of the C. canephora genome in the tetraploid interspecific hybrid ( C. arabicax C. canephora). Theor Appl Genet. v.104, n.4, Mar, p.661-668. 2002.

HERRERA, J. C., et al. Factors influencing gene introgression into the allotetraploid Coffea arabica L. from its diploid relatives. Genome. v.47, n.6, Dec, p.1053-1060.

2004.

HERRERA, J. C., et al. Use of fluorescence in situ hybridization as a tool for introgression analysis and chromosome identification in coffee (Coffea arabica L.).

Genome. v.50, n.7, Jul, p.619-26. 2007.

HOEKEMA, A., et al. A binary plant vector strategy based on separation of vir- and T-region of the Agrobacterium tumefaciens Ti-plasmid. Nature. v.303, 12 May 1983, p.179 - 180. 1983.

IBGE. Produção Agrícola 2009 – primeiras estimativas da safra 2009, em nível nacional, em relação à produção obtida em 2008. 2009.

http://www.ibge.gov.br/home/estatistica/indicadores/agropecuaria/lspa/default.shtm.

ICO. Trade Statistics. 2009. http://www.ico.org/trade_statistics.asp.

IGNACIMUTHU, S.PRAKASH, S. Agrobacterium-mediated transformation of chickpea with α-amylase inhibitor gene for insect resistance. Journal of biosciences. v.31, n.3, p.339–345. 2006.

ISHIMOTO, M., et al. Bruchid resistance of transgenic azuki bean expressing seed alpha-amylase inhibitor of common bean. Entomologia Experimentalis Et Applicata. v.79, n.3, Jun, p.309-315. 1996.

IULEK, J., et al. Purification, biochemical characterisation and partial primary structure of a new alpha-amylase inhibitor from Secale cereale (rye). Int J Biochem Cell Biol. v.32, n.11-12, Nov-Dec, p.1195-204. 2000.

IULEK, J., et al. Crystallization and X-ray crystallographic studies of an inhibitor from rye (Secale cereale) active against Acanthoscelides obtectus and Zabrotes subfasciatus alpha-amylases. Protein Pept Lett. v.11, n.1, Feb, p.79-83. 2004.

JARAMILLO, J., et al. Coffee berry borer Hypothenemus hampei (Coleoptera:

Curculionidae): searching for sustainable control strategies. Bulletin of Entomological Research. v.96, p.223–233. 2006.

JARAMILLO, J., et al. Where to sample? Ecological implications of sampling strata in determining abundance and impact of natural enemies of the coffee berry borer, Hypothenemus hampei. Biological Control. v.Accepted Manuscript. 2008.

KASAHARA, K., et al. Complete sequence, subunit structure, and complexes with pancreatic alpha-amylase of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. Journal of Biochemistry. v.120, n.1, Jul, p.177-183. 1996.

KIM, Y. H., et al. Cloning and functional expression of the gene encoding an inhibitor against Aspergillus flavus alpha-amylase, a novel seed lectin from Lablab purpureus (Dolichos lablab). Plant Cell Rep. v.26, n.4, Apr, p.395-405. 2007.

KLUH, I., et al. Inhibitory specificity and insecticidal selectivity of alpha-amylase inhibitor from Phaseolus vulgaris. Phytochemistry. v.66, n.1, Jan, p.31-9. 2005.

KUMAR, V., et al. Stable transformation and direct regeneration in Coffea canephora P ex. Fr. by Agrobacterium rhizogenes mediated transformation without hairy-root phenotype. Plant Cell Rep. v.25, n.3, Mar, p.214-22. 2006.

LASHERMES, P., et al. Molecular characterisation and origin of the Coffea arabica L.

genome. Mol Gen Genet. v.261, n.2, Mar, p.259-66. 1999.

LASHERMES, P., et al. Single-locus inheritance in the allotetraploid Coffea arabica L. and interspecific hybrid C. arabica x C. canephora. The Journal of Heredity. v.91, n.1, p.81-85. 2000.

LEE, S. C., et al. Protein structures of common bean (Phaseolus vulgaris) alpha-amylase inhibitors. Journal of Agricultural and Food Chemistry. v.50, n.22, p.6618-6627. 2002.

LEROY, T., et al. Genetically modified coffee plants expressing the Bacillus thuringiensis cry1Ac gene for resistance to leaf miner. Plant Cell Reports. v.19, n.4, Mar, p.382-389. 2000.

LLOYD, G.MCCOWN, B. Commercially feasible micropropagation of montain laurel, Kalmia latifolia, by use of shoot tip culture. Combined Proceedings of the International Plant Propagator’s Society. v.30, p.421-427. 1981.

LU, S., et al. Solution structure of the major alpha-amylase inhibitor of the crop plant amaranth. J Biol Chem. v.274, n.29, Jul 16, p.20473-8. 1999.

MACGREGOR, E. A., et al. Relationship of sequence and structure to specificity in the alpha-amylase family of enzymes. Biochim Biophys Acta. v.1546, n.1, Mar 9, p.1-20. 2001.

MAHE, L., et al. Development of sequence characterized DNA markers linked to leaf rust (Hemileia vastatrix) resistance in coffee (Coffea arabica L.). Molecular Breeding. v.21, n.1, Jan, p.105-113. 2008.

MARSHALL, J. J.LAUDA, C. M. Purification and properties of phaseolamin, an inhibitor of alpha-amylase, from the kidney bean, Phaseolus vulgaris. J Biol Chem.

v.250, n.20, Oct 25, p.8030-7. 1975.

MARTINS, J. C., et al. Solution structure of the main alpha-amylase inhibitor from amaranth seeds. Eur J Biochem. v.268, n.8, Apr, p.2379-89. 2001.

MORENO, J.CHRISPEELS, M. J. A lectin gene encodes the alpha-amylase inhibitor of the common bean. Proc Natl Acad Sci U S A. v.86, n.20, Oct, p.7885-9. 1989.

MORTON, R. L., et al. Bean alpha-amylase inhibitor 1 in transgenic peas (Pisum sativum) provides complete protection from pea weevil (Bruchus pisorum) under field conditions. Proceedings of the National Academy of Sciences of the United States of America. v.97, n.8, Apr, p.3820-3825. 2000.

NAHOUM, V., et al. A plant-seed inhibitor of two classes of alpha-amylases: X-ray analysis of Tenebrio molitor larvae alpha-amylase in complex with the bean Phaseolus vulgaris inhibitor. Acta Crystallogr D Biol Crystallogr. v.55, n.Pt 1, Jan, p.360-2. 1999.

NAHOUM, V., et al. Crystal structures of human pancreatic alpha-amylase in complex with carbohydrate and proteinaceous inhibitors. Biochem J. v.346 Pt 1, Feb 15, p.201-8. 2000.

NCBI. Taxonomy Databank. 2009.

http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=13442.

O’CALLAGHAN, M., et al. Effects of plants genetically modified for insect resistance on nontarget organisms. Annual Review of Entomology. v.50, p.271–292. 2005.

OBIRO, W. C., et al. The nutraceutical role of the Phaseolus vulgaris alpha-amylase inhibitor. Br J Nutr. v.100, n.1, Jul, p.1-12. 2008.

OGITA, S., et al. Application of RNAi to confirm theobromine as the major intermediate for caffeine biosynthesis in coffee plants with potential for construction of decaffeinated varieties. Plant Mol Biol. v.54, n.6, Apr, p.931-41. 2004.

OGITA, S., et al. Producing decaffeinated coffee plants. Nature. v.423, n.6942, Jun 19, p.823. 2003.

ORTIZ, A., et al. Volatile composition of coffee berries at different stages of ripeness and their possible attraction to the coffee berry borer Hypothenemus hampei (Coleoptera : Curculionidae). Journal of Agricultural and Food Chemistry. v.52, n.19, Sep, p.5914-5918. 2004.

PAVA-RIPOLL, M., et al. Increased pathogenicity against coffee berry borer, Hypothenemus hampei (Coleoptera : Curculionidae) by Metarhizium anisopliae expressing the scorpion toxin (AaIT) gene. Journal of Invertebrate Pathology. v.99, n.2, Oct, p.220-226. 2008.

PAYAN, F. Structural basis for the inhibition of mammalian and insect alpha-amylases by plant protein inhibitors. Biochimica Et Biophysica Acta-Proteins and Proteomics. v.1696, n.2, Feb, p.171-180. 2004.

PDB. RCSB Protein Data Bank. 2009. http://www.rcsb.org/pdb/home/home.do.

PERTHUIS, B., et al. Stable resistance against the leaf miner Leucoptera coffeella expressed by genetically transformed Coffea canephora in a pluriannual field experiment in French Guiana. Euphytica. v.144, n.3, Aug, p.321-329. 2005.

PRESCOTT, V. E., et al. Transgenic expression of bean alpha-amylase inhibitor in peas results in altered structure and immunogenicity. J Agric Food Chem. v.53, n.23, Nov 16, p.9023-30. 2005.

PRIVAT, I., et al. Differential regulation of grain sucrose accumulation and metabolism in Coffea arabica (Arabica) and Coffea canephora (Robusta) revealed through gene expression and enzyme activity analysis. New Phytologist. v.178, n.4, p.781-797. 2008.

PUEYO, J. J., et al. Activation of Bean (Phaseolus vulgaris) [alpha]-Amylase Inhibitor Requires Proteolytic Processing of the Proprotein. Plant Physiology. v.101, n.4, Apr, p.1341-1348. 1993.

PUSZTAI, A., et al. Expression of the insecticidal bean alpha-amylase inhibitor transgene has minimal detrimental effect on the nutritional value of peas fed to rats at 30% of the diet. Journal of Nutrition. v.129, n.8, Aug, p.1597-1603. 1999.

REISNER, A. H., et al. The use of Coomassie Brilliant Blue G250 perchloric acid solution for staining in electrophoresis and isoelectric focusing on polyacrylamide gels. Analytical Biochemistry. v.64, p.509-516. 1975.

REKHA, M. R., et al. Inhibitor potential of protease and alpha-amylase inhibitors of sweet potato and taro on the digestive enzymes of root crop storage pests. Journal of Stored Products Research. v.40, n.4, p.461-470. 2004.

RIBAS, A. F., et al. Genetic transformation of Coffea canephora by particle bombardment. Biologia Plantarum. v.49, n.4, Dec, p.493-497. 2005.

RIBAS, A. F., et al. Production of Herbicide-Resistant Coffee Plants (Coffea canephora P.) via Agrobacterium tumefaciens-Mediated Transformation. Brazilian Archives of Biology and Technology. v.49, n.1, p.11-19. 2006.

RICKETTS, T. H., et al. Economic value of tropical forest to coffee production. Proc Natl Acad Sci U S A. v.101, n.34, Aug 24, p.12579-82. 2004.

ROCHA, T. L., et al. Eletroforese bidimensional e análise de proteomas.

Embrapa Recursos Genéticos e Biotecnologia. Brasília. 2005

ROZEN, S.SKALETSKY, H. J. Primer3 on the WWW for general users and for biologist programmers. In: KRAWETZ, S.MISENER, S. (Ed.). Bioinformatics Methods and Protocols: Methods in Molecular Biology. Totowa, NJ: Humana Press, 2000.

Primer3 on the WWW for general users and for biologist programmers, p.365-386

SALES, M. P., et al. Do legume storage proteins play a role in defending seeds against bruchids? Plant Physiology. v.124, n.2, Oct, p.515-522. 2000.

SAMBROOK, J.RUSSELL, D. W. Molecular Cloning a Laboratory Manual. New York: Cold Spring Harbor Laboratory Press. 2001

SANTIMONE, M., et al. Porcine pancreatic alpha-amylase inhibition by the kidney bean (Phaseolus vulgaris) inhibitor (AI1) and structural changes in the alpha-amylase inhibitor complex. Biochim Biophys Acta. v.1696, n.2, Feb 12, p.181-90.

2004.

SAWADA, S., et al. Primary structures of alpha- and beta-subunits of alpha-amylase inhibitors from seeds of three cultivars of Phaseolus beans. J Protein Chem. v.21, n.1, Jan, p.9-17. 2002.

SCHROEDER, H. E., et al. Bean a-Amylase lnhibitor Confers Resistance to the Pea Weevil (Bruchus pisorum) in Transgenic Peas (Pisum sativum). Plant Physiology.

v.107, p.1233-1 239. 1995.

SERA, T., et al. IPR 98: Rust-resistant dwarf arabica coffee cultivar for dense spacing. Crop Breeding and Applied Biotechnology. v.8, n.3, Sep, p.242-244.

2008.

SILVA, D. P., et al. Identification of an alpha-amylase inhibitor from Pterodon pubescens with ability to inhibit cowpea weevil digestive enzymes. J Agric Food Chem. v.55, n.11, May 30, p.4382-7. 2007.

SOLLETI, S. K., et al. Transgenic cowpea (Vigna unguiculata) seeds expressing a bean alpha-amylase inhibitor 1 confer resistance to storage pests, bruchid beetles.

Plant Cell Rep. v.27, n.12, Dec, p.1841-50. 2008.

SONIA, et al. Agrobacterium tumefaciens mediated transfer of Phaseolus vulgaris alpha-amylase inhibitor-1 gene into mungbean Vigna radiata (L.) Wilczek using bar as selectable marker. Plant Cell Rep. v.26, n.2, Feb, p.187-98. 2007.

SOUZA, J. C.REIS, P. R. Broca do café: Histórico, reconhecimento, biologia, prejuízos, monitoramento e controle. Belo Horizonte, v.50. 1997. 40 p. (Boletim Técnico - EPAMIG)

SPIRAL, J., et al. Obtention de plantules de Coffea canephora Pierre (Robusta) transformés par Agrobacterium rhizogenes. Comptes rendus de l'Académie des sciences. v.316, n.1, p.1-6. 1993.

SUZUKI, K., et al. cDNA sequence and deduced primary structure of an alpha-amylase inhibitor from a bruchid-resistant wild common bean. Biochim Biophys Acta. v.1206, n.2, Jun 12, p.289-91. 1994.

TABASHNIK, B. E. Delaying insect resistance to transgenic crops. Proc Natl Acad Sci U S A. v.105, n.49, Dec 9, p.19029-30. 2008.

TEIXEIRA, J. B., et al. Multiplicação clonal de café (Coffea arábica L.) via embriogênese somática. Brasília. 2004

VALENCIA-JIMENEZ, A., et al. Activity of alpha-amylase inhibitors from Phaseolus coccineus on digestive alpha-amylases of the coffee berry borer. J Agric Food Chem. v.56, n.7, Apr 9, p.2315-20. 2008.

VALENCIA, A., et al. Alpha-amylases of the coffee berry borer (Hypothenemus hampei) and their inhibition by two plant amylase inhibitors. Insect Biochemistry and Molecular Biology. v.30, p.207–213. 2000.

VALIO, I. F. M. Germination of coffee seeds (Coffea arabica L. CV Mundo Novo).

Journal of Experimental Botany. v.27, n.100, p.983-991. 1976.

VOELKER, T., et al. Differences in expression between two seed lectin alleles obtained from normal and lectin-deficient beans are maintained in transgenic tobacco. The EMBO Journal. v.6 n.12, p.3571–3577. 1987.

WATSON, K.ACHINELLI, M. L. Context and contingency: the coffee crisis for conventional small-scale coffee farmers in Brazil. The Geographical Journal. v.174, n.3, p.223–234. 2008.

WHETSTONE, P. A.HAMMOCK, B. D. Delivery methods for peptide and protein toxins in insect control. Toxicon. v.49, p.576–596. 2007.

YOUNG, N. M., et al. Post-translational processing of two alpha-amylase inhibitors and an arcelin from the common bean, Phaseolus vulgaris. FEBS Lett. v.446, n.1, Mar 5, p.203-6. 1999.

ZAMBOLIN, L. Produção integrada de café. Viçosa: Universidade Federal de Viçosa. 2003

ZHANG, X. B., et al. A mechanism of cell death involving an adenylyl cyclase/PKA signaling pathway is induced by the Cry1Ab toxin of Bacillus thuringiensis.

Proceedings of the National Academy of Sciences of the United States of America. v.103, n.26, Jun, p.9897-9902. 2006.

ZHUANG, M. B., et al. Heliothis virescens and Manduca sexta lipid rafts are involved in Cry1A toxin binding to the midgut epithelium and subsequent pore formation.

Journal of Biological Chemistry. v.277, n.16, Apr, p.13863-13872. 2002.

Anexo 1. Seqüência de proteínas e de DNA do inibidor αAI-1, e seqüência de DNA do gene nptII.

Seqüência de proteínas do αAI-1

MIMASSKLLSLALFLALLSHANSATETSFIIDAFNKTNLILQGDATVSSNGNLQLSYNSYDS MSRAFYSAPIQIRDSTTGNVASFDTNFTMNIRTHRQANSAVGLDFVLVPVQPESKGDTVTVE FDTFLSRISIDVNNNDIKSVPWDVHDYDGQNAEVRITYNSSTKVFSVSLSNPSTGKSNNVST TVELEKEVYDWVSVGFSATSGAYQWSYETHDVLSWSFSSKFINLKDQKSERSNIVLNKIL Seqüência de DNA do gene αAI-1

ATGGCTTCCTCCAAGTTACTCTCCCTAGCTCTCTTCCTTGCGCTTCTCAGCCACGCAAACTC AGCCACCGAAACCTCCTTCATCATCGATGCGTTCAACAAAACCAACCTTATCCTTCAAGGCG ATGCCACCGTCTCATCCAACGGCAACTTACAACTATCCTATAATTCATACGACTCTATGAGC AGAGCCTTCTACTCCGCCCCCATCCGAATCAGGGACAGCACCACCGGCAACGTCGCCAGCTT CGACACCAACTTCACAATGAATATCCGCACTCACCGCCAAGCAAATTCCGCCGTTGGCCTTG ACTTTGTTCTCGTCCCCGTCCAGCCCGAATCCAAAGGCGATACTGTGACTGTGGAGTTCGAC ACCTTCCTCAGCCGTATTAGCATCGACGTGAACAACAACGATATCGAAAGCGTGCCTTGGGA TGTACACGACTACGACGGACAAAACGCCGAGGTTCGGATCACCTATAACTCCTCCACGAAGG TCTTCTCGGTTTCTCTGTCAAACCCCTCTACGGGAAAGAGCAACAACGTCTCTACCACAGTG GAGCTGGAGAAAGAAGTTTACGACTGGGTGAGCGTTGGGTTCTCTGCCACCTCAGGGGCTTA TCAATGGAGCTATGAAACGCACGACGTCCTCTCTTGGTCTTTTTCTTCCAAGTTCATCAATC TTAAGGACCAAAAATCTGAACGTTCCAACATCGTCCTCAACAAAATCCTTTAG

Seqüência de DNA do gene nptII

ATGGGGATTGAACAAGATGGATTGCACGCAGGTTCTCCGGCCGCTTGGGTGGAGAGGCTATT CGGCTATGACTGGGCACAACAGACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAG CGCAGGGGCGCCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAACTCCAG GACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGCTGTGCTCGA CGTTGTCACTGAAGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTGCCGGGGCAGGATCTCC TGTCATCTCACCTTGCTCCTGCCGAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTG CATACGCTTGATCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAGC ACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGACGAAGAGCATCAGGGGC TCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGCGCATGCCCGACGGCGAGGATCTCGTC GTGACACATGGCGATGCCTGCTTGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATT CATCGACTGTGGCCGGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTG ATATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTACGGTATCGCC GCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTTCTTGACGAGTTCTTCTGA

Anexo 2. Soluções para Southern blot (BRASILEIRO, A. C. M., 1998).

Solução de desnaturação

Componente Quantidade Concentração final

NaoH 10 N 25 mL 0,5 N

NaCl 5 M 150 mL 1,5 M

H2O q.s.p. 500 mL

Solução de Neutralização

Componente Quantidade Concentração final

Tris-HCl 1M, pH 7,2 250 mL 0,5 M

NaCl 5 M 150 mL 1,5 M

H2O q.s.p. 500 mL

SSC 20X

Componente Quantidade Concentração final

NaCl 175,3 g 3 M

Citrato de sódio 88,2 g 0,3 M

H2O q.s.p. 1000 mL

Solução de pré-hibridização

Componente Quantidade Concentração final

Componente Quantidade Concentração final